PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.6G253600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family Nin-like
Protein Properties Length: 1070aa    MW: 117537 Da    PI: 5.8052
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.6G253600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK82.73.6e-26696746252
              RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         ek+ sl++l+kyFs+++++A+ +Lgvc+T+LKriCRq+GI+RWP+Rki+++
  Sevir.6G253600.1.p 696 EKNFSLDVLRKYFSGSLREASMSLGVCPTTLKRICRQHGISRWPSRKINKV 746
                         899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.677680766IPR003035RWP-RK domain
PfamPF020421.3E-23699746IPR003035RWP-RK domain
SuperFamilySSF542776.45E-249611050No hitNo description
Gene3DG3DSA:3.10.20.2408.4E-239641046No hitNo description
SMARTSM006661.1E-209671049IPR000270PB1 domain
PROSITE profilePS5174525.5569671049IPR000270PB1 domain
PfamPF005641.1E-169681048IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1070 aa     Download sequence    Send to blast
MAPSPPGKGK GKKKDDIDDL PEEDLALKEQ LELYVLRAQD ADPGVQKLAL ESMSQEIRSA  60
TSSMTSVPKP LKFLRPHYGA LKSYFETMPE SELKKYMADI LSVLALTMSV EGERESLKYR  120
LLGSEGDIGS WGHEYVSPMG PSDDPFGVAA MMNFDGYSEV CSPSVADQIF SMLNDPSAAQ  180
QMFAMWSSLG SSPCASAVRE DMPFDTYSEP VDMTAAPAQR INSASPLGPT GVNRELKVSD  240
ELVPNNGSQQ GTNIIPRSVG NVLADKMLMA LSLFRKSLSD GVLAQVWMPI EHNGRIVLST  300
FEQPFLLDQD LAGYREVSRN FLFSVKEEPG LHLGLPGRVF ISGVPEWTSS VLYYSKPEYL  360
RMDHALRHEI RGSLAMPIYD PSKGSCCAVL ELVTNKEKPD FDAEMDSVCN ALQAVNLQTA  420
TDRSSQKVPL FTSNMLHVYS ENQKSAFIEI LDVLRAICHA HMLPLALTWV PTSNGIDNGY  480
CVRNNIGVDS QSGKTVLRIH ESACYINDAK MQGFLHACAE RHLEKGQGIA GRALKSNLPF  540
FSPDVREYNI EDYPLAHHAR KFGLHAAVAI RLRSTYTGND DYILEFFLPV NCKGCGEQQM  600
LLNNLSSTMQ RICKSLRTVS EAEADSVSAS VASMNKKSNG SLPTGNSESS SQDDQPITES  660
AFQDLSLADK QEQDIESDQA QASSMRVAEK KRSTSEKNFS LDVLRKYFSG SLREASMSLG  720
VCPTTLKRIC RQHGISRWPS RKINKVNRSL KKIQTVINSV HGVDRSLQYD PATGSLVPAA  780
SLPDKMPFSA YDSLPTSSVG KTMEEKSSPK SEQGFSSPDG WQREDCQFHV SNISKREGEG  840
DEVRMLANNN NGSRNYAPDV AKFTPHSNSK DAQGPLYPIV VNSLRIGETG YTNSPTSLHP  900
SIDDQTMGRN SSFVQQADVT MVDGHDTKEH THPSTSGMTD SSSGSASSQP TFKGNPGYVI  960
KDRSSPALTV KATYNGDTVR FKFLPAMGWY HLLEEIAKRF RLTTGAFQLK YKDDEDEWVI  1020
LASDSDLQEC VDILDSIGSR NVKLQVRDLP CLISSSGSSS CLQVTGRET*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jco_Z5e-22241364215426S proteasome regulatory subunit RPN1
3jcp_Z5e-22241364215426S proteasome regulatory subunit RPN1
4cr2_Z5e-22241364215426S PROTEASOME REGULATORY SUBUNIT RPN1
4cr3_Z5e-22241364215426S PROTEASOME REGULATORY SUBUNIT RPN1
4cr4_Z5e-22241364215426S PROTEASOME REGULATORY SUBUNIT RPN1
5a5b_Z5e-22241364215426S PROTEASOME REGULATORY SUBUNIT RPN1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7277560.0KJ727756.1 Zea mays clone pUT5699 NLP transcription factor (NLP3) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660870.10.0PREDICTED: LOW QUALITY PROTEIN: protein NLP2-like
SwissprotQ0JC270.0NLP2_ORYSJ; Protein NLP2
TrEMBLK3YG180.0K3YG18_SETIT; Uncharacterized protein
STRINGSi013186m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36703573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.21e-178Nin-like family protein